DPCstruct | MC49887
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 96 ± 6 aa |
| Standard deviation of domain lengths | 5.97 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 76.82 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 39.81 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0015 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6V7QMV6 | 42-131 | TNSMRFLNKAAVKGGSDTKWSLCCVTQVEETKQILRMLPILVTMFIPCTIISQTNTLFVKQGTTLNRHMGRHFQIPPASLGAFVTLT… |
| A0A816J650 | 157-248 | TKSLRFLDRASLKTGTTDQWNLCTITEVEETKQMLNMLPAMFATFVPSAMVAQVDTLFVKQGTILNARIAGNFSIPPASLSAFVTVS… |
| A0A803M3P8 | 326-429 | None |
| A0A287WTR8 | 57-154 | None |
| A0A2P2NGB9 | 73-162 | None |
| A0A6A3AMT4 | 104-207 | None |
| M8C848 | 89-177 | None |
| A0A6A6KF54 | 178-277 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.