DPCstruct | MC49884
Metacluster Properties and Pfam Annotations
| Number of structural domains | 29 |
|---|---|
| Mean domain length (aa) | 114 ± 19 aa |
| Standard deviation of domain lengths | 18.70 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 71.20 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.49 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 35.67 |
| Pfam Score | 81.29 |
| Assigned Pfam label(s) | CL0093- PF06943 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3S3QMI7 | 8-108 | VNCTTCHTPLQLPSGAKSIRCAICHAITHVADPCGLPPGPIPATPGPPPSPHGRKKAVICGISYRYSRHELKGCLNDAKCMKYLLIN… |
| A0A2Z6M245 | 21-118 | NLSGNGNGSVFVSVYNYNFSMHYPPTTYGTPFLSYYPPSRPPSAFGNKRAVLFGISSADTATPRKLRGFVNNAKLMKQLLIDKLGFP… |
| A0A834TQD1 | 8-127 | None |
| A0A3S4P7R6 | 29-127 | None |
| A0A4Y1R279 | 5-123 | None |
| A0A5N5JE19 | 4-142 | None |
| A0A0A0L401 | 11-129 | None |
| D7MR93 | 7-140 | None |
| A0A284S262 | 104-178 | None |
| A0A6P8D3B6 | 134-213 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.