DPCstruct | MC4988
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 99 ± 13 aa |
| Standard deviation of domain lengths | 12.92 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 83.39 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 37.68 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF11947 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Z5KH03 | 51-151 | AIPEKVAQRMGKRMIPFVGIPLFLSMGVFVGFWYMATYRYMSFEPSLVAASTILILVLGLLGITYSVMSTSWDPDREGSLLGTDEFS… |
| A0A812SNI8 | 2-98 | PQPVAERVAKRGMVIGGSFYATMIAVFALGIFLVKTQEIIIPPTLMAFVTLALLGLAIFGGSYGMMSASWDPEKEGSALGAEEFSEN… |
| A0A7S2STX2 | 119-217 | None |
| M1V5L5 | 120-220 | None |
| A0A388KMT3 | 375-477 | None |
| A0A2W4WK10 | 97-197 | None |
| A0A2I0X1H7 | 131-229 | None |
| A0A2R6PHL7 | 1-90 | None |
| K0S8T8 | 4-153 | None |
| G4FL42 | 1-89 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.