DPCstruct | MC49879
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 302 ± 37 aa |
| Standard deviation of domain lengths | 37.21 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 80.59 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 66.78 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0727 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2Z6LG64 | 2-286 | WDSFMVGVAVSIMSKPYNYKGENEFSEMEYMNITVVTSNKPYGISDGSNPLINGLNVPKFNLEKGGVHSGHIQQGLRDPLCFVKNGK… |
| A0A452Z379 | 5-356 | QVFHSGIPITLVPLDATNTIPVNEEFFYAFQQHQSTFEAEYCFKSLKMARDTWSDDQFHASYFMWDSFTSGVAISGMRNDKDCLHGN… |
| A0A3L6REQ6 | 155-462 | None |
| A0A087G350 | 58-416 | None |
| A0A6A1VRA4 | 330-627 | None |
| A0A2Z6MXS6 | 1-274 | None |
| A0A287FV76 | 3-224 | None |
| A0A287FV62 | 2-345 | None |
| A0A287FV25 | 199-474 | None |
| A0A3Q7EID9 | 367-650 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.