DPCstruct | MC49875
Metacluster Properties and Pfam Annotations
| Number of structural domains | 33 |
|---|---|
| Mean domain length (aa) | 133 ± 13 aa |
| Standard deviation of domain lengths | 13.09 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 83.36 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 33.50 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF03733 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1J5RIT2 | 2-142 | TRILNLLWFLLGGGLLALGWLLAAGLMAVTIVGLPWARSALVIARMAATPFGVEAVDRDLLTGRNDIGTGPLGVVGNVVWFFLAGLW… |
| A0A0F2RW45 | 2-128 | FLAWLLAAFVMVITIIGIPWARSAFNIALYSLWPFGREAVDRSLLTGQEDLGTSPLGMLGNVIWFVLAGWWLALGHVMAAIATALTI… |
| A0A7S4NLD5 | 54-171 | None |
| A0A7C2X975 | 14-146 | None |
| A0A369S736 | 71-199 | None |
| A0A369S725 | 164-295 | None |
| A0A3A9D208 | 1-144 | None |
| A0A420CYS9 | 1-146 | None |
| A0A4R2JNX1 | 4-126 | None |
| A0A7V5YH38 | 2-135 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.