DPCstruct | MC49865
Metacluster Properties and Pfam Annotations
| Number of structural domains | 34 |
|---|---|
| Mean domain length (aa) | 221 ± 36 aa |
| Standard deviation of domain lengths | 36.32 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 89.19 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 22.11 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF18916 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A259U2D5 | 1-239 | MTYLGFHLTFTLPAIAALWVFRPRAGQAWWPLGVLVAIAFVYTTPWDNYLVAQGVWTYPPDRVLATVGYVPVEEYAFFVLQTVLSGL… |
| A0A3B9H5K1 | 29-250 | KYLYLLIDGLTLAGPLVLSFDRRVAFFRRWKYLFPSIGLMMAIFVPWDMVFTHMGVWGFNPQYLSGYQIFNLPIEEVLFFVVVPYAC… |
| A0A2R6LAA0 | 5-264 | None |
| A0A835CPX3 | 502-734 | None |
| A0A2C6A2K9 | 5-215 | None |
| A0A1L9WTV1 | 1-280 | None |
| A0A7C1JHG3 | 86-329 | None |
| A0A7S2BCS2 | 19-275 | None |
| A0A2E7MBH9 | 39-285 | None |
| A0A7C5U0P3 | 6-211 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.