DPCstruct | MC49852
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 124 ± 14 aa |
| Standard deviation of domain lengths | 14.02 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 78.83 |
| Mean fraction of residues predicted as intrinsically disordered | 0.45 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 54.56 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0382 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5N5NZ72 | 1-111 | MVYLHLQNAVLDEPTEDSLIGMLSHIGLMRDPPARKNMVPYEVWAKMPPDPEILALEAERAHLKGGQYRIKGTKNEVRIRKLTAMIA… |
| A0A366P4M2 | 66-200 | DQIMRQDPRFMTFQSAYLNENANFDIQNAFLEEEKESQLFRLFAHVSLTRDPRATADMVPDEVWANLAPDPEITELEEQRAQLKQGK… |
| A0A4Q4T258 | 288-422 | None |
| J5J635 | 46-180 | None |
| A0A4Q4ZRV3 | 1-138 | None |
| A0A0C3A0Q7 | 17-121 | None |
| A0A420PAM8 | 180-314 | None |
| G2QM32 | 2-134 | None |
| A0A428RUJ3 | 46-181 | None |
| A0A2H3G7P9 | 329-464 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.