DPCstruct | MC49846
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 93 ± 6 aa |
| Standard deviation of domain lengths | 6.30 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 90.17 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 34.72 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1H0MCQ9 | 10-97 | LQATAERALGEGDPVRAWVWQYVALARGDDLTHSTLAARHDGGSNDGEFYDSDFGGPLYVDGNEGLVLPELDSLQHKVAKATARDILR |
| K6XKF9 | 9-111 | PVILINFYLDWLKAEMIVAPSREGLIEIIEAPINETEKWFWYYVGLQHDIDVTKDCYRAINADTGEDYDDYGPVVAVGDDGVALPII… |
| A0A1K1Y9G7 | 127-222 | None |
| A0A847VN85 | 2-89 | None |
| A0A0F0FK50 | 6-95 | None |
| A0A0S2FJ95 | 44-145 | None |
| A0A520GR19 | 11-90 | None |
| A0A2R7T2I7 | 185-276 | None |
| A0A379K016 | 200-296 | None |
| A0A7W2NWV0 | 6-97 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.