DPCstruct | MC49840
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 154 ± 25 aa |
| Standard deviation of domain lengths | 25.01 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 84.06 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 18.20 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1H7EFS9 | 1-145 | MGSTVLTGKQAAAFRTADGEWMFALFERTYEKNCYPHDDRWSAIAFGRYRDVMRRVFRHATSCEGGMLQSRAGNIRPENYIATWRSV… |
| A0A059ZYP3 | 1-114 | MSVTYTCKRVAAAFRDGDDVVYALGEVTYESNVYPHTRHLSTTFIGKLPDAIKTVFAFAADTCGGDLNSPDRKMTPERYIKSALNAL… |
| A0A154R4U6 | 15-203 | None |
| A0A1C6HFT1 | 1-158 | None |
| A0A1V5MNY4 | 1-180 | None |
| A0A328UFA7 | 1-159 | None |
| A0A5A9EXM3 | 1-172 | None |
| A0A1V5UT25 | 9-160 | None |
| A0A1C2JMK7 | 1-116 | None |
| A0A1H1KM62 | 1-131 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.