DPCstruct | MC49835
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 138 ± 10 aa |
| Standard deviation of domain lengths | 9.80 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 83.48 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.92 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 60.73 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0316 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0A0KI47 | 54-187 | VGKFFVSFLVVVLVWEIPGVFDVLWEPFTFLLGYKDPNRKVENLPPMYEWHFRTALDRYIWILGMIYAYYYSTIEKWIEKLDDAKLK… |
| A0A1D6EFW9 | 138-270 | MAIKIAGCLLTVILIWEIPGVFEIFWAPFTFLLGYKNPEPSKMNLPLLHEWRFRSGLDRYIWIIGMIYAYFHPNVERWMEKLEESET… |
| A0A453I829 | 300-431 | None |
| A0A835IP48 | 192-350 | None |
| A0A2P2LHB9 | 76-206 | None |
| A0A287P2H5 | 1-147 | None |
| A0A2C9K1L7 | 190-322 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.