DPCstruct | MC49833
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 135 ± 8 aa |
| Standard deviation of domain lengths | 8.13 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 81.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 43.55 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A178VZK0 | 462-604 | PSLVPEKLSKQKELVDFVETILGLVPSNYPLALSVSKLLRKEEKQSDSGSSSGIHFWAGLNLASTISCAIPVAPEYIWVEAGEIVSD… |
| A0A103YD62 | 1135-1269 | PSLLPPQSSERVTDIVDFAEALMEMRPGNYQLALCICKTYSGVNASISFWASAVLMDSLFQAVPVAPESVWVEAAGMLKRLADFTSM… |
| A0A7I8JZX6 | 1-118 | None |
| A0A6A2YBH0 | 942-1080 | None |
| A0A444C6Q2 | 801-938 | None |
| A0A803R309 | 393-521 | None |
| A0A1P8B0L2 | 1451-1592 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.