DPCstruct | MC49828
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 141 ± 16 aa |
| Standard deviation of domain lengths | 15.69 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 83.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 55.90 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5P1FIR8 | 1-133 | MTAVALFNWGNVHISRARKRLFLSEDTSKESVLQQVKEAHSWAREEYVKAGKRYEGALKFKPDFYEGLLALGQQQFEQAKLSWYYAI… |
| A0A835IWX6 | 1-162 | MVTSKFQEVSALAFLNWGNVHMCAARKRIPLDDNASKEVMIAQLQLAYDWVKEKYALAGEKYEEALKIKPNFYEGLFALGHQHFETA… |
| A0A1R3GUA8 | 313-454 | None |
| A0A833QFR4 | 27-171 | None |
| A0A314ZMG5 | 208-334 | None |
| A0A0V0IUV4 | 275-431 | None |
| A0A834ZNI4 | 685-839 | None |
| A0A7J7H2C8 | 264-413 | None |
| A0A6A6MA10 | 439-546 | None |
| A0A833V9W5 | 3-132 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.