DPCstruct | MC4982
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 79 ± 8 aa |
| Standard deviation of domain lengths | 8.21 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 94.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.44 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 33.66 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A101WQW7 | 14-90 | PGGGLMYVITPQAILDFEEGTKRMRLKHVIPPATLEEIKGNTGFELVIPDYLEELPEPTADEIEVLRNRVDRKGLLR |
| A0A0U1DXP4 | 97-169 | ANIYRVVSNLGVFDFNGPDHQMRAVSLHPGVEAQQVADNTSFEVHGLEEAETTRLATDEELKLLREVIDPKSL |
| X0XS50 | 2-70 | None |
| A0A2C6MGI2 | 91-179 | None |
| A0A521XCB2 | 11-86 | None |
| A0A7C5QIY9 | 202-285 | None |
| A0A840QD79 | 110-192 | None |
| A0A7V6Y9J5 | 320-395 | None |
| A0A645IS13 | 45-130 | None |
| A0A7K0SHE5 | 152-224 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.