DPCstruct | MC49817
Metacluster Properties and Pfam Annotations
| Number of structural domains | 103 |
|---|---|
| Mean domain length (aa) | 150 ± 31 aa |
| Standard deviation of domain lengths | 30.91 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 87.78 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 37.28 |
| Pfam Score | 97.44 |
| Assigned Pfam label(s) | PF13966- CL0059- PF13968 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A835IJW9 | 591-752 | CWAEDPNSDAFKYHLARIRDYLWIAEDGMKMQNLGSQSWDAFFAIQAILACNLLEEYGPTLKRGHEFLKKSQVQENPQGDFRSMYRH… |
| A0A5J6SDC9 | 134-290 | TINMLVRWHVEGPQSPAFQEHVSRITDYLWLGLDGLKMQGTNGSQLWDTAFAVQALLEAGAQNIPAFTDCLNQAHAYFEVTQVRDNP… |
| A0A5N5JBD8 | 215-355 | None |
| K3Y8T4 | 30-190 | None |
| A0A1E5UPY1 | 5-151 | None |
| A0A2G5D0F0 | 368-564 | None |
| A0A7V8VDQ5 | 293-476 | None |
| A0A396HCQ5 | 76-229 | None |
| A0A2G2X280 | 27-195 | None |
| A0A1U8F763 | 4-148 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.