DPCstruct | MC49813
Metacluster Properties and Pfam Annotations
| Number of structural domains | 114 |
|---|---|
| Mean domain length (aa) | 145 ± 22 aa |
| Standard deviation of domain lengths | 21.51 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 73.55 |
| Mean fraction of residues predicted as intrinsically disordered | 0.40 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 22.50 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14420 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A317T1U1 | 11-139 | ENYKMREITPAEWEERREMFTRLYFNEDRRLDDVRRIMATEYGFYANDTQCKKKIKKWELGKSLNRGAACAMLRIQKRRHTEGKETV… |
| W9W6L2 | 2-106 | EHRSNARALPICEAEWDRRRSVIEGLYRLHELTDVIERMERDFGFRATDKQYKRQFARWGIRKNISSKDMKGVLGKPIENATVRGVQ… |
| A0A2J6TR29 | 1-169 | None |
| A0A194XU18 | 1-176 | None |
| A0A507BKW9 | 36-198 | None |
| A0A2H3TPG9 | 1-95 | None |
| A0A1J7IJY2 | 77-243 | None |
| U7Q8R4 | 34-196 | None |
| A0A0G4LEQ7 | 232-365 | None |
| A0A0A1SVD5 | 401-536 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.