DPCstruct | MC49812
Metacluster Properties and Pfam Annotations
| Number of structural domains | 60 |
|---|---|
| Mean domain length (aa) | 243 ± 37 aa |
| Standard deviation of domain lengths | 36.81 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 75.02 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 19.81 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A317T1D6 | 1-216 | MPAASKSGSPDFFDAISEPVEARPLEPNTSDPARNQSPTLPYCAQHNITTSLQSILEGACFKFAKCHVPELLTRKRWTCAHSAELSM… |
| W9C9G1 | 175-430 | QIPQFESPRLVDGIYTVKSLAMKVMPKPHCPSGYPKQHPNLPCLPFVLQITIIRSLQTALESICYRFVEKWLPKILVANGWDCPDAI… |
| A0A2H3G7T3 | 193-469 | None |
| A0A395SZW5 | 70-335 | None |
| A0A1V8S8S6 | 200-462 | None |
| A0A395T128 | 40-277 | None |
| A0A370TZJ2 | 74-358 | None |
| N1RT62 | 75-358 | None |
| A0A3N4L811 | 93-376 | None |
| A0A367L9F4 | 184-465 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.