DPCstruct | MC4981
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 77 ± 10 aa |
| Standard deviation of domain lengths | 9.95 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 92.24 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 54.33 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF03692 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| H2JFG6 | 1-79 | MECRKYCGACCIAPSISSSIPGMPKGKPAGVRCVQLNSDNSCRIFGSPERPKVCSSLRPSREMCGESGQFALEYLCKLE |
| A0A1H7SJ56 | 1-72 | MECTRCGACCVAPDIAALDKPLGMRCPHLSEENLCTVYDRRPSVCRSYQADEVCRLIEAPTLDERVQKYLEL |
| A0A4R4BMQ4 | 13-108 | None |
| A0A1G3QIT2 | 1-65 | None |
| H8GQJ2 | 1-84 | None |
| A0A250L1G6 | 53-132 | None |
| A0A7T9GUD1 | 1-79 | None |
| A0A380NSV6 | 1-80 | None |
| A0A158INH4 | 56-134 | None |
| A0A7C1UZ16 | 1-79 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.