DPCstruct | MC49809
Metacluster Properties and Pfam Annotations
| Number of structural domains | 52 |
|---|---|
| Mean domain length (aa) | 109 ± 18 aa |
| Standard deviation of domain lengths | 18.34 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 86.74 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 22.04 |
| Pfam Score | 20.00 |
| Assigned Pfam label(s) | CL0063- PF08593- PF07957 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A317SHT1 | 111-219 | DNPDQHFEDMNMQLQDMSVQLDDLNQALEAVDCNASARLNNSLASADSRLSPLRTAQNQYVTGFPGTLSCLDRLNTNNVNALLAAYT… |
| A0A0D2N2M8 | 78-186 | QAVEEKVQGLKARLHGVEVGVAGLQKQMMFSTRNAIARSQNSTMHAPASPLVPLVNVMTGDPIGGFPGTISELNALTGPTIRATLAA… |
| A0A2T6ZHH1 | 34-155 | None |
| A0A2A9P9R6 | 88-207 | None |
| A0A0K6FUA2 | 26-144 | None |
| A0A0K6FZQ6 | 3-125 | None |
| A0A0K6G521 | 15-143 | None |
| A0A4U0XTT9 | 27-133 | None |
| K2SV56 | 8-108 | None |
| A0A4R0RKT6 | 5-114 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.