DPCstruct | MC498
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 183 ± 18 aa |
| Standard deviation of domain lengths | 18.40 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 80.44 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 25.38 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10699 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2R7W362 | 439-617 | SELWYSVYNLREPFTSHAVNMDIFEKHCFEHRKNTWIKENEGLKVRVSTFQRRVTDGLPTQVFSYTPLQTIDREYVCLEASQAILLV… |
| A0A453LDM3 | 2-164 | GDWFHVFEIVGRSTGYSIRVQVKKGSSVTEVIVSPENKTVVSKDNFLRVNLIGDFVSHNSMPTFEDFYLVTPRKAGGDGQPQVLGDE… |
| A0A5E4GNU5 | 31-218 | None |
| J9KKT5 | 86-305 | None |
| A0A6A0A4C3 | 112-285 | None |
| A0A0A9F5V5 | 1-163 | None |
| A0A6P3Y5Y7 | 71-283 | None |
| A0A6P6GK76 | 56-217 | None |
| F2UNH3 | 248-420 | None |
| A0A818IHG9 | 364-533 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.