DPCstruct | MC49796
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 323 ± 94 aa |
| Standard deviation of domain lengths | 93.50 |
| Length coefficient of variation | 0.29 |
| Mean AlphaFold2 pLDDT confidence score | 73.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.50 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 31.83 |
| Pfam Score | 88.10 |
| Assigned Pfam label(s) | PF10312- PF09732 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| K3YC24 | 1-306 | PSAAAVSERLAARGLGAFVWRKKLDRGLSRGVLPGIVRSERRRCLARRKEADGVKASAAPRRASPPPPVAPALARAEEEAKEAAFLL… |
| A0A087SQ04 | 78-339 | PFVWGKKIEKQIAEGVDVREMSAKAEAKRHQSRLEEAEKVKKRQEQREAEREAMQAELEMIQRERAAAEAVELERKQEDFLLEQSKM… |
| A0A1V9ZIY3 | 67-325 | None |
| A0A200R9P6 | 638-1193 | None |
| A0A7J6VM91 | 117-451 | None |
| A0A068VHH4 | 63-442 | None |
| A0A0V0XYL7 | 164-420 | None |
| A0A803LBB4 | 1-292 | None |
| B4DSX7 | 207-435 | None |
| A0A0F7SYR0 | 155-476 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.