DPCstruct | MC49795
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 104 ± 3 aa |
| Standard deviation of domain lengths | 2.77 |
| Length coefficient of variation | 0.03 |
| Mean AlphaFold2 pLDDT confidence score | 91.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 49.18 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6P5TLV3 | 161-265 | LPVPEGEFRSSLQGNSSNELEFCVESGDPAIVTSQSPKAVFVNCGNHPFDLLKESMKILEKHFGTFSLRESKQMPGMLDWFGWCTWD… |
| A0A6A6MUU4 | 85-187 | LPLLEGPFRASLQPGDDDNIDICVESGSTKVSATGFRSILYVHVGDDPFNLVKEATKVVRLHLGTFKLLEEKTPPGIVDKFGWCTWD… |
| A0A6P4LLZ3 | 174-275 | None |
| A0A453C7V6 | 37-139 | None |
| A0A3B6GLX1 | 138-240 | None |
| A0A1D6E8C2 | 43-149 | None |
| A0A427A6W4 | 41-134 | None |
| A0A287WEY1 | 48-150 | None |
| K3Y5P6 | 255-361 | None |
| A0A2N9GEK3 | 264-366 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.