DPCstruct | MC49792
Metacluster Properties and Pfam Annotations
| Number of structural domains | 177 |
|---|---|
| Mean domain length (aa) | 125 ± 18 aa |
| Standard deviation of domain lengths | 17.61 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 82.54 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 12.82 |
| Pfam Score | 63.40 |
| Assigned Pfam label(s) | PF08750- PF16747 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A840UJZ6 | 35-174 | THWVWVSADSKYGKLYAPDRVTVTSRKNGVPVRIEAWIKTTYSATGAAETVPAMKLSKEIPVASTLRYSLALVEINPQSRTLDYLEE… |
| A0A225MDH8 | 11-138 | CFAANAFCAPSWVPLTVPGSTRYLVDSGSLRPGGDATTDIAVLAEFPQPLAAAFDARLHYRSTITGYRIDCANRYAWVLNVSYYASG… |
| A0A1X1Q8I6 | 209-317 | None |
| A0A532E1E4 | 35-152 | None |
| A0A5C6UH08 | 4-103 | None |
| A0A318AQW3 | 2-133 | None |
| A0A7M2Y9I0 | 33-178 | None |
| A0A229FVZ0 | 41-172 | None |
| A0A7X6CA08 | 52-161 | None |
| A0A5F0WK33 | 4-109 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.