DPCstruct | MC49782
Metacluster Properties and Pfam Annotations
| Number of structural domains | 415 |
|---|---|
| Mean domain length (aa) | 191 ± 35 aa |
| Standard deviation of domain lengths | 34.68 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 90.59 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.46 |
| Mean intra-cluster sequence similarity (%) | 17.97 |
| Pfam Score | 68.71 |
| Assigned Pfam label(s) | CL0268- CL0220- PF07589- CL0103- PF00082 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Q3P514 | 399-573 | DVTVTMDANAGGFSARDIWRNDIAGVGRFTKQGSGELSLAGANTYTGGTLIEAGAVRAASANALGTGAVYINGGSLVTDANDAVNVA… |
| A0A1Q5A3A1 | 199-380 | ASLTKQGPGTLIMTGDETYEGGTTVEGGKLSITGSHASSIDVKGGTLGGSGSVGDSVTVTSGVLRPGLASEEAAQLTGTSAGNVLNV… |
| A0A2P7BAV6 | 448-624 | None |
| L7VTJ9 | 961-1171 | None |
| A0A4Q2XB37 | 150-370 | None |
| A0A4Q2X9M3 | 3-115 | None |
| A0A4Q2XYL9 | 102-334 | None |
| A0A6N7F0L8 | 389-599 | None |
| A0A6N7EUE3 | 82-272 | None |
| A0A0H5DSD7 | 548-738 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.