DPCstruct | MC4978
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 101 ± 12 aa |
| Standard deviation of domain lengths | 12.38 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 86.93 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 34.69 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF20370 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A397PE39 | 3-92 | EAAAEQVDQEILEEKAASLTRAGRRVETALKAIRAYDAGEQPDADRGELLDEAARAVWALLIQRELCGFRDEKRTIEQYDIPRDVMV… |
| A0A1H0QFS5 | 7-98 | RSGYAVLQDELAQEKASALGRLGRRLEDALAALAACPREDSDRETRRKLVEQAGYALWLFVVQRESCGFNDSVRMMRQYGVPKEVFA… |
| A0A1J5QM88 | 1-110 | None |
| A0A1G5P1L5 | 1-120 | None |
| A0A4U6C655 | 1-104 | None |
| A0A525L119 | 2-82 | None |
| I7ZBW4 | 3-96 | None |
| F2A8E2 | 146-250 | None |
| A0A4R3FCS4 | 68-174 | None |
| A0A285R773 | 1-114 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.