DPCstruct | MC49775
Metacluster Properties and Pfam Annotations
| Number of structural domains | 78 |
|---|---|
| Mean domain length (aa) | 301 ± 68 aa |
| Standard deviation of domain lengths | 68.46 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 81.93 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 23.43 |
| Pfam Score | 98.72 |
| Assigned Pfam label(s) | PF20478- PF00864 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A183NVN5 | 1-163 | MIKNNIEFPHFRVKRRNILNWMSRLFLKTCLYNPNDDKLKYCPIFRLGDILKYSDPVNKDIWETGGMVSIHIEWNCNLDFDEEKCLP… |
| A0A668ADR2 | 46-359 | RWVFLHEKAYQIRDTAIESSVMTKVKGFGIYNNRVMDVADYVTPPQGGSMFCIITKLITTENQVQSYCPEVRYINTSSNLLFICNTS… |
| A0A0G4H0H9 | 33-435 | None |
| A0A1Q9CHT0 | 326-657 | None |
| A0A1D2NCG2 | 13-344 | None |
| A0A814WIN8 | 6-417 | None |
| A0A814T371 | 137-421 | None |
| A0A7S2K2B7 | 28-255 | None |
| A0A6I9PYE3 | 3-178 | None |
| A0A6J2BQ83 | 30-316 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.