DPCstruct | MC49770
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 77 ± 3 aa |
| Standard deviation of domain lengths | 2.86 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 92.77 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.96 |
| Mean intra-cluster local Distance Difference Test score | 0.91 |
| Mean intra-cluster sequence similarity (%) | 54.61 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0S4QF69 | 58-136 | MTVDFSGTSPAVRGNVNCPRAVTRSACCFALRVLLPEDVPTGDGTYAPLTVVTEPGSLVDARRPSAVVAGNVETSQRIA |
| A0A1G0LYH7 | 58-135 | RCDFGGTAPATEGNVNCPIAVTRSAALFAARCLIPADVPTNGGVARCVEVVAPEGCLVHARPPSAVAAGNVETSQRIA |
| A0A7X8D6N0 | 166-243 | None |
| A0A7W1JNU0 | 104-180 | None |
| A0A6L9ZS97 | 554-631 | None |
| A0A6P0TGF2 | 398-475 | None |
| A0A7T1MFE0 | 453-530 | None |
| A0A101PH92 | 109-175 | None |
| A0A0N1IEG7 | 21-98 | None |
| A0A7J7R138 | 44-121 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.