DPCstruct | MC4977
Metacluster Properties and Pfam Annotations
| Number of structural domains | 757 |
|---|---|
| Mean domain length (aa) | 249 ± 56 aa |
| Standard deviation of domain lengths | 56.01 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 85.19 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.49 |
| Mean intra-cluster local Distance Difference Test score | 0.43 |
| Mean intra-cluster sequence similarity (%) | 14.82 |
| Pfam Score | 84.53 |
| Assigned Pfam label(s) | CL0020- CL0379- CL0305- PF00817- CL0105 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1H0PJ03 | 6-274 | FAILTGLKEEIETLLAAIPDLKEVAGEQQSDVWYRGRIGSERGYGYSIVATLARDMGPVPATLLTQHIIARWNPAHIILLGIAGSFS… |
| A0A1U8CXV7 | 7-195 | SIMLHELIKLLHHAKCQGVTIIRIGTSGGLGIEPGSVVITDTALDSFFKPQFEQVILDNVVVRSTELDKDLAEELLNCSKEIHDFPT… |
| A0A497P2P0 | 8-261 | None |
| A0A538Q5N0 | 15-267 | None |
| A0A538PYW0 | 9-263 | None |
| A0A7R9L7I4 | 2-162 | None |
| A0A519KCC2 | 119-372 | None |
| A0A6P5H839 | 1-226 | None |
| A0A7S4E1S7 | 30-284 | None |
| A0A1V2LL59 | 413-682 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.