DPCstruct | MC49762
Metacluster Properties and Pfam Annotations
| Number of structural domains | 40 |
|---|---|
| Mean domain length (aa) | 178 ± 27 aa |
| Standard deviation of domain lengths | 26.91 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 81.55 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.50 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 22.04 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF08463 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J4T4H7 | 1-188 | PAKAAFRTLDVKDDIYIRTWVEINGKPVPKSAYKEIVEQFISGLVSQSDAVRKVKDGEVVSPDEIDEIVLLFEGCEHPISVENLREA… |
| A0A7U9P7S2 | 2-151 | NLIPALQIVCTRPKDLTRQDLRELITILETKGFKLSHLQTAWKQAKNEEIAADIISFIRQAALGDALIDHETRVKRAMQKVYSLHDW… |
| A0A2E9VKI4 | 112-302 | None |
| A0A0J9EUF1 | 43-225 | None |
| A0A4R8UBW3 | 206-406 | None |
| A0A087CTX1 | 999-1215 | None |
| A0A844FJ68 | 3-132 | None |
| A0A317MT04 | 15-143 | None |
| A0A7W0ZDN8 | 13-190 | None |
| W0DMX5 | 2-169 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.