DPCstruct | MC49761
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 77 ± 9 aa |
| Standard deviation of domain lengths | 8.67 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 87.98 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 43.74 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1S1GH23 | 3-78 | IRRQALFLLLAALPLAASAAAPRTFQEAKKIGWKLYARQSVEFYCGCRYKGNRVDLASCGYVPRKNAKRAARIEWE |
| A0A378BQS8 | 12-66 | FSQAKAAGVKVNADVPGDFYCGCKIDWQGKKGVIDLESCGYKVRKNENRASRVEW |
| A0A2G0Y4T9 | 2-88 | None |
| A0A5E5Q4B0 | 3-79 | None |
| A0A2W4MBA5 | 1-90 | None |
| A0A1J8PY62 | 2-82 | None |
| A0A5E6XB86 | 1-68 | None |
| A0A376FGR1 | 12-84 | None |
| A0A1H6K7F3 | 1-81 | None |
| A0A6D0M1Y4 | 3-74 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.