DPCstruct | MC4976
Metacluster Properties and Pfam Annotations
| Number of structural domains | 183 |
|---|---|
| Mean domain length (aa) | 121 ± 21 aa |
| Standard deviation of domain lengths | 21.43 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 85.23 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 16.79 |
| Pfam Score | 98.39 |
| Assigned Pfam label(s) | CL0192- CL0082- CL0023- CL0123 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2Z6TJ72 | 2-114 | REGKPAAYRAALVDGVHRALMHTFNVPEDDIFMVVTEHAAENFVFGRRYLDIERSDDLVMIQITANNTRTLEQKQALYRTIVANLAQ… |
| A0A1H0A448 | 1-115 | MPIMVCETAQRLDKPKRAALAKSITQSVHEVIGSDLDLISVVFHELEQDQIWLAGQPSQDALILCYIRAGRPVALKTELALRVSAAW… |
| A0A7H9UJU4 | 1-102 | None |
| E9G3A7 | 257-366 | None |
| A0A4V1XQK1 | 4-138 | None |
| A0A840RXN8 | 31-162 | None |
| A0A1G1AFG7 | 29-143 | None |
| A0A6I9Y8P8 | 112-220 | None |
| A0A318ALB0 | 1-151 | None |
| A0A146H7Z8 | 1-149 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.