DPCstruct | MC49756
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 107 ± 5 aa |
| Standard deviation of domain lengths | 5.31 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 80.57 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 36.47 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| Q5BAE4 | 155-259 | YDIVSSCQPMDWSTTSKALFSDPKKFFKSLQNLPFARGLPPSRISQQPGHASILKKAIVCDGIHESSFKNKGAELKKDLAYIWENEW… |
| A0A0C2X403 | 359-459 | EIFHSQFPISELWLDLDKSSRFRRGLPSLNELQSPKIARVLRAVLSNNHVTKEMMESPDDKQALRQCFEMGWLHATVYQWDTMYIFT… |
| C8VPB1 | 33-137 | None |
| A0A2T5M6F7 | 1-118 | None |
| A0A5N7C5T8 | 370-475 | None |
| A0A5J5FB72 | 1-109 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.