DPCstruct | MC49744
Metacluster Properties and Pfam Annotations
| Number of structural domains | 31 |
|---|---|
| Mean domain length (aa) | 82 ± 10 aa |
| Standard deviation of domain lengths | 9.95 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 85.47 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 38.62 |
| Pfam Score | 60.00 |
| Assigned Pfam label(s) | CL0123- CL0219 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Y2V3V2 | 8-84 | EYLSKWEEEIKKGGNLFDKYSILDSWTYDRFVEARENYQQVTNRNLQQWALAAAGQFAEFEFKASESWVKKFKTSMV |
| A0A815RCX3 | 187-264 | THPMQLKRFREYVASNGNRRQKLERVEHFVLDRFRSARNNNLPVHDLDVKRWALCQAKIENIDGFKASDYWLLNFKKR |
| A0A818G233 | 138-218 | None |
| A0A6L5DHW7 | 4-78 | None |
| A0A819ZVK9 | 143-219 | None |
| A0A820ARB2 | 138-216 | None |
| A0A815FU75 | 3-95 | None |
| A0A815SAI7 | 135-213 | None |
| A0A1D1W7P2 | 143-238 | None |
| A0A815R951 | 70-150 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.