DPCstruct | MC49741
Metacluster Properties and Pfam Annotations
| Number of structural domains | 239 |
|---|---|
| Mean domain length (aa) | 122 ± 21 aa |
| Standard deviation of domain lengths | 21.32 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 79.65 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 19.44 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | CL0123- PF01031 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Y2V092 | 13-135 | SEAVFISVDSSVTAKDVESMIGLPITPCLISSGDDSVATSYMVAVDKKIINEEIKSFETGFFMVFAAYYILNIEYAEMAGATLEFIQ… |
| A0A2C9LUD9 | 332-447 | LCLLPLHFGENFVEMVLEIGEDEEVVPQGKIVPTLVARGNIFRTDEFFLIAENTIVQEFEEFTIAFASLYSSYWVFNMMYPETIENT… |
| A0A6A4KGW9 | 395-575 | None |
| A0A1A8BKJ4 | 212-333 | None |
| A0A835CTW9 | 67-202 | None |
| A0A226F1P0 | 667-792 | None |
| A0A3B4UV56 | 27-100 | None |
| A0A3S1BEW6 | 459-579 | None |
| A0A7J6D4V4 | 9-116 | None |
| A0A7J6CXW7 | 69-160 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.