DPCstruct | MC4974
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 73 ± 5 aa |
| Standard deviation of domain lengths | 4.57 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 88.21 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 39.86 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2I0GX04 | 25-96 | KTRLIEGLRDQYLLSDLLKTARIPRSSFYYHRTTLSHKDKYAHIKQRIADLYHKHKGRYGYRRITVALKQSG |
| A0A3Q8WTL9 | 1-77 | MRTLAVATLKSDYNLAVLLEIARLPRSTFYYHLRALNRPDRHAAVKALITEIFSSRQGRYGHRRIRLCRRQLKSEQF |
| A0A8A7MHW3 | 25-89 | None |
| A0A554QED0 | 162-232 | None |
| A0A1H9VFP2 | 29-100 | None |
| A0A2V2KZ30 | 2-68 | None |
| A0A315ZMS1 | 186-263 | None |
| A0A198GNA4 | 18-96 | None |
| A0A3D5U113 | 13-83 | None |
| A0A2L0LVV8 | 42-123 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.