DPCstruct | MC49738
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 215 ± 20 aa |
| Standard deviation of domain lengths | 20.13 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 93.99 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 35.20 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0103 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7W6TT21 | 1-182 | MQRERNFFAYQDIESSFEKRPSLWMEPIGDWGEGGVVLFEIPTKEEVHDNIAALWRPKNPLQAKGEHNYTYRLHWGPDSPKPHSLAR… |
| A0A655X0X0 | 145-361 | MINGRGERLWRPLANPSTLQVSAFMDNSPQGFGLMQRERDYANYQDLEAHYEKRPSLWVEPVGNWGPGAVVLTEIPTQSEIHDNIVA… |
| A0A6A5KY21 | 937-1165 | None |
| A0A3M5YZ86 | 295-507 | None |
| A0A1W6ZIV4 | 406-641 | None |
| J2KVH3 | 243-454 | None |
| A0A1T5GZ95 | 497-718 | None |
| A0A455U6Y7 | 1-158 | None |
| A0A2V6W274 | 10-226 | None |
| A0A257QA82 | 5-224 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.