DPCstruct | MC4973
Metacluster Properties and Pfam Annotations
| Number of structural domains | 50 |
|---|---|
| Mean domain length (aa) | 313 ± 56 aa |
| Standard deviation of domain lengths | 56.33 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 85.00 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 26.03 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A380GYY2 | 3-263 | PNYWSGTKFNVNKELTKLGYRVHEANVGAFSSNYDGAVELYYYIKGGRVDYGAARAEKYGHNRYGRTYEGIMPDWEPGKKIHLVGHS… |
| A0A1S1F6R5 | 174-518 | TESLKTNKAQQAINQYPVIFVHGFMGFTGEIKPDLYPNYWGGDKYRVIDGLREKGYEAYEASVGAFSSNYDRAIELYYYIKGGTVDY… |
| A0A7X2MY19 | 25-222 | None |
| A0A6V7PSQ0 | 71-288 | None |
| K3WFI3 | 273-555 | None |
| A0A5D2L3U9 | 2-307 | None |
| G4ZH12 | 16-359 | None |
| A0A355KXY2 | 30-380 | None |
| A0A7X0XEA1 | 2-319 | None |
| X0HMB2 | 29-317 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.