DPCstruct | MC49729
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 259 ± 44 aa |
| Standard deviation of domain lengths | 44.47 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 89.57 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 27.09 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0344 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1W9SFG6 | 32-279 | DNAILLLWLLFILVTGFLVEGTRIAATEPAWKTWSPVGAFVGTAFTADARLWHSMFWWIHMLASFGFIAYMPFSRLKHIFTSAMNIY… |
| J9DUT9 | 103-425 | VGYEFFVELIAAATGVGIVALIGIRQSTRIFRPGRKSRFYGSGNKKAYYVEATILAVVFCVIALRGLEGALLGVDSWNWHYAISYPA… |
| A0A7Y2DFF3 | 19-291 | None |
| A0A535DIT7 | 119-382 | None |
| A0A2N9AM84 | 105-366 | None |
| A0A7X8R7I7 | 116-394 | None |
| A0A3B0S223 | 126-405 | None |
| A0A3S4G8C7 | 2-199 | None |
| A0A1G9ZFB0 | 1-194 | None |
| A0A511MWB3 | 105-418 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.