DPCstruct | MC49728
Metacluster Properties and Pfam Annotations
| Number of structural domains | 55 |
|---|---|
| Mean domain length (aa) | 178 ± 36 aa |
| Standard deviation of domain lengths | 35.54 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 78.33 |
| Mean fraction of residues predicted as intrinsically disordered | 0.39 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 32.14 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0C3GUY4 | 24-211 | NGPTKGIESNTYSNAFVFFKKRELQGIKPPRKKVKKADEQPKIDVSDVHLDGEDTEEVEVYETCDEVRKKVNAYLRQPNVTQAGFCR… |
| A0A094AWK6 | 2-108 | DVSSIHLDGEEHENVPVYDTCDEVREKIKAFLCQDGVTQAEFLREVAKTFGNGRKIQANMLNRFLGKKGLNSGNVSSIFHAGYVFFE… |
| A0A0N0NJU1 | 53-241 | None |
| A0A7S8DDX9 | 17-179 | None |
| A0A4Q4X7S8 | 5-114 | None |
| A0A2H3S812 | 22-191 | None |
| A0A1Y2DQY0 | 22-237 | None |
| A0A080ZHD5 | 24-179 | None |
| A0A1L7VZF5 | 102-287 | None |
| A0A395RKN5 | 74-273 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.