DPCstruct | MC49727
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 108 ± 6 aa |
| Standard deviation of domain lengths | 5.79 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 89.27 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 29.51 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0C3GR22 | 1-120 | MILEDRQVCSGVTGETNTERYGAKAAEEVAAFQPAHIYALKQVMEHEKINCDFILIRTLEVLFDQAQTDSLDAIYHEKLRSCVGMLD… |
| A0A3L6NR46 | 123-229 | AARNCKKYNTSAAAEIVQFEARHLDVIKSLIRSEAIDCDFAETESLAVLTTLEQVSMVREAYEGLKQASSFSDTLLDVIEFYEGGDA… |
| A0A1Q5QBH8 | 111-218 | None |
| A0A1S8A777 | 1-101 | None |
| N4UJU4 | 94-200 | None |
| F0XGF6 | 96-207 | None |
| A0A101M9K5 | 809-915 | None |
| A0A3M7ENM7 | 81-191 | None |
| A0A1V6PLM2 | 97-195 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.