DPCstruct | MC49726
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 139 ± 15 aa |
| Standard deviation of domain lengths | 14.81 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 80.18 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 38.35 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0C3GQZ5 | 4-171 | LESYVRHEKASQPQAAEIIHGPINLFDVALKGVESGYRQCFRFCLLTSPTTVIANLKAGKADYDPEERQRISGNKSLARDTAFQLLH… |
| A0A010S014 | 263-387 | MPTRLSDYHSLCETLRSRQVDVLAGRSLRDIMRDMRQGKDDWDPDERRTIAGFKSLARDSAFRLLYALVLDLPGVSDQNMAFNATMF… |
| L7IZE3 | 442-577 | None |
| A0A2P4ZB96 | 932-1088 | None |
| A0A401L9T5 | 17-156 | None |
| L2FPU7 | 1-129 | None |
| A0A5N5Q310 | 1-137 | None |
| A0A5N5PV47 | 88-224 | None |
| A0A0M9ENV0 | 361-483 | None |
| A0A1L9U1J0 | 54-181 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.