DPCstruct | MC49720
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 168 ± 29 aa |
| Standard deviation of domain lengths | 28.99 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 89.65 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 27.88 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF13651 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7V2ECT8 | 1-169 | KDFIVLGNVLNVTYDKVLKQIAENKIFIGHSIHSGDVKFLVPDDYEIYGQKFEIKDNKKYIWVKGIRWFTTLNHNKFPNLELKYELD… |
| A0A422M0U1 | 59-225 | KQFLIIGNENAITYKEIFPLFQQNKLWFGYNNGHYWFRVPSSYGAKKTDYKVDDEGNTWRRMGNIGWFTNIDIEKRHQSLDLVFRYE… |
| A0A6I6R027 | 23-184 | None |
| A0A1I5XWD1 | 396-572 | None |
| A0A5C8FW30 | 272-423 | None |
| Q50290 | 135-317 | None |
| R6R011 | 122-346 | None |
| A0A1I7IFI2 | 239-404 | None |
| A0A2S0WY38 | 181-391 | None |
| A0A6I0VB61 | 310-464 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.