DPCstruct | MC4972
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 167 ± 16 aa |
| Standard deviation of domain lengths | 15.95 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 87.22 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 20.37 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| R9LVH8 | 33-211 | YSSNTSDEDCYLCGGGIESLVPSYWGQDNIALISLNTFEIKPLEINRYDRLNGQLIEEYAGVVSFGGGGSTDGGFSASLMLDYDRGY… |
| A0A415CZ57 | 9-181 | QEECALCGSRKESMTGMFSGKDAIGIISVNDWYIMDLKIKSGNEKENMPEDTEGKNTTRTTVGKNGRVLERSSESLRGISEIVVDYG… |
| A0A3E3DRT8 | 3-157 | None |
| A0A3A9FIE3 | 57-255 | None |
| A0A351TJU0 | 41-202 | None |
| A0A3E4TRV1 | 1-161 | None |
| A0A1C6C5T4 | 23-188 | None |
| A0A1C5UI47 | 4-159 | None |
| F7JJK5 | 34-228 | None |
| A0A2Z4U781 | 121-273 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.