DPCstruct | MC49718
Metacluster Properties and Pfam Annotations
| Number of structural domains | 39 |
|---|---|
| Mean domain length (aa) | 73 ± 13 aa |
| Standard deviation of domain lengths | 12.65 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 93.32 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 40.26 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0171 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7V1JDH5 | 8-70 | IKDFDKIYGIHDLAAGDVIFVATGVTNGDYLNGVKFFQSGAKTHSVFMRSKTGTIRYIEANHY |
| A0A7Y0WYT6 | 2-50 | FSATGITKGDLLEGISRQGNIATTETLLVRGRCRTIRRIKSTHYLERKD |
| A0A7Y2IRK7 | 4-57 | None |
| A0A0B0D8S6 | 5-70 | None |
| A0A7V9EW77 | 1-46 | None |
| A0A7V3H741 | 55-131 | None |
| A0A5B8MRD8 | 713-800 | None |
| A0A0M1P4G6 | 1-63 | None |
| A0A6B2DBZ9 | 214-274 | None |
| A0A7W1KWP4 | 2-58 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.