DPCstruct | MC49710
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 70 ± 6 aa |
| Standard deviation of domain lengths | 5.98 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 83.41 |
| Mean fraction of residues predicted as intrinsically disordered | 0.49 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 37.25 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7T9QCQ0 | 6-87 | KVIIFMGIALIFFGIGSFWFLSFPHKAQEPSSVKVKNNQTSITNFDECVLAGNPIMESYPRGCMTQDGRSFVEILTEEAQLP |
| A0A1F7JA12 | 6-72 | STKKYLLFALAMLIFIVIVISLYKQYRLNNIHSFEDCANAGYPIMLSYPGQCRTPDGRMFSEQLNEE |
| A0A1G2QE90 | 4-69 | None |
| A0A0G0HC15 | 59-141 | None |
| A0A0G0S4G3 | 4-69 | None |
| A0A497IBA6 | 4-75 | None |
| A0A1F6FSH6 | 3-74 | None |
| A0A0G1YX11 | 6-71 | None |
| A0A832BDR7 | 4-68 | None |
| A0A1F5Z998 | 1-69 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.