DPCstruct | MC49706
Metacluster Properties and Pfam Annotations
| Number of structural domains | 47 |
|---|---|
| Mean domain length (aa) | 243 ± 31 aa |
| Standard deviation of domain lengths | 30.51 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 67.93 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 20.15 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A243UU51 | 23-220 | KKFGSVLAGTTANVIKMGLAVEGAALSVVAFTAKIASGLDNLYWASQRTGATVQGIQSIGYAVSQVGGSVDAARSSLESLSRFIRNN… |
| A0A4Q2RGB9 | 2-277 | DEFTTRAQSFQRGGAGVGVVMSGLGVSGLAAGAGIASAVAAFRDLANRAVDLKETARLTGLTTVQIQQLDRAAKDLNVDPNQLNAGL… |
| A0A1V5UQF6 | 82-303 | None |
| A0A6N8HVA2 | 144-376 | None |
| A0A0C1GCL8 | 85-325 | None |
| A0A2D8S0F7 | 48-378 | None |
| A0A3M2WWE9 | 29-311 | None |
| A0A846QLW4 | 92-365 | None |
| A0A0T9Q3X5 | 12-301 | None |
| A0A5C1A9P5 | 32-265 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.