DPCstruct | MC49702
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 90 ± 6 aa |
| Standard deviation of domain lengths | 6.40 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 83.84 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 38.69 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0123 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2H5SW14 | 1-91 | MDTQYDPGSLTWNNLHTLNEEHMYCYCGKDRNLTEVSLQCSGCLNWFHAKCTKISIDTNIPIFTNYKFTCKWCNNSSSESFKDGKKL… |
| B4DR98 | 7-91 | SLPYGLKGLDWDAGHLSNRQQSYCYCGGPGEWNLKMLQCRSCLQWFHEACTQCLSKPLLYGDRFYEFECCVCRGGPEKVRRLQLR |
| A0A2P6NXC1 | 63-149 | None |
| A0A1Y1V6W2 | 18-108 | None |
| A0A3S3S4K7 | 2-106 | None |
| A0A1Y2APY1 | 1-89 | None |
| A0A443SDV4 | 21-102 | None |
| A0A1Y3NHE4 | 1-89 | None |
| A0A1Y1WVF9 | 10-94 | None |
| A0A7S3S6J1 | 7-96 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.