DPCstruct | MC4970
Metacluster Properties and Pfam Annotations
| Number of structural domains | 45 |
|---|---|
| Mean domain length (aa) | 78 ± 10 aa |
| Standard deviation of domain lengths | 10.46 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 81.19 |
| Mean fraction of residues predicted as intrinsically disordered | 0.60 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 41.96 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF15526 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A414P0K3 | 3-84 | SKESQQAAKKLGYEKTNYRAKNGEPIYYNKKTKTYISQDIGSADGSGPHNGGVWKMGKSPQELNSKSTRLGTYDGNLNRIGD |
| A0A2X2KBF0 | 31-109 | TSPQVAAQAAKKLGYSATKHVSHGKKVFKKNSKGRPQYISVDKDGHRGGAWKGASSIKNLGSKKTRSGTYDANLKRIGD |
| A0A2A6I419 | 116-192 | None |
| A0A377LUH6 | 115-189 | None |
| A0A4Y9FH42 | 85-160 | None |
| D3UXB4 | 441-512 | None |
| E0N6L1 | 54-145 | None |
| A0A1H0U244 | 150-232 | None |
| A0A0J5H0G8 | 135-214 | None |
| A0A6G3TLU5 | 4-87 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.