DPCstruct | MC497
Metacluster Properties and Pfam Annotations
| Number of structural domains | 36 |
|---|---|
| Mean domain length (aa) | 83 ± 11 aa |
| Standard deviation of domain lengths | 10.58 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 80.69 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 45.85 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00631 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A507CV62 | 1-64 | MSEIKLKKLLELNQRLKETLDLPRIPVSEASTSLIKYITSTKDFLLPSVWGSVDKKDDPYSAPS |
| A0A286UVG6 | 50-131 | SSETHTQPLPVHQLKLRRLIEHNQRLREDLARPRVRVSEASASLIQYCKTTKDHLVPSVWGPVGRGEDPYAPPAQGCQCVIM |
| A0A2S4KTM6 | 7-93 | None |
| A0A4T0JIG3 | 279-359 | None |
| A0A0F7SR15 | 1-69 | None |
| G4TGX3 | 8-79 | None |
| J6F309 | 15-96 | None |
| A0A284QW56 | 113-202 | None |
| Q6CHP5 | 1-108 | None |
| A0A1B9HZJ6 | 31-115 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.