DPCstruct | MC49696
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 271 ± 31 aa |
| Standard deviation of domain lengths | 30.70 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 68.48 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.33 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 31.73 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2H5SFJ7 | 40-308 | KELNTLYEIITEQGYEIEKLNIERLFRLGFDRYELVVDGFIRKYLENQERDDKDVQKSLMQYLAKKGYREISDKKSDEFNESDNVEE… |
| A0A372QHI2 | 11-248 | VLTEDFLGAFFERKDLSDKKLKEEIEDWLKQETIECNDCGNRKLPYILKIGTEICENCEQKELLELKDDLEKLDYEMDISEIQRIRD… |
| A0A372QA88 | 189-433 | None |
| A0A015L700 | 1-292 | None |
| A0A015KG84 | 186-466 | None |
| A0A015KFL1 | 3-236 | None |
| A0A372Q4S7 | 1-261 | None |
| A0A2N0P6I1 | 178-504 | None |
| A0A2H5RI01 | 205-492 | None |
| A0A2N1M9T1 | 1-313 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.