DPCstruct | MC4969
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 123 ± 9 aa |
| Standard deviation of domain lengths | 9.37 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 89.48 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 28.71 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| B6WTK8 | 2-106 | SVDDVTVVFFARHPERKVACVVGWYRNALVFRKEQQEFLDGQKVKYSAKARAEDCICLQEQERSFAIPSGHIVKGGYGQGTMWYADS… |
| A0A3E4LHP4 | 13-132 | KKEESVDDVLVVYCAKHPAHKFTMVVGWYKHATVFRHYQEAVFAPEDIQFYNAMAKSSDCVLLPAGIRSRKVQWEVPRKSSGWAYGF… |
| A0A120FJE9 | 1-143 | None |
| A0A3N6AF89 | 70-192 | None |
| A0A4Q2R6G2 | 547-679 | None |
| A0A1Q7L179 | 13-132 | None |
| A0A1V5XGY7 | 263-377 | None |
| A0A415NU30 | 130-245 | None |
| S5ZKR7 | 58-187 | None |
| R7FEL8 | 76-210 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.